Recombinant Human Parathyroid Hormone Protein, >97% (SDS-PAGE&HPLC)

Cat. No.: rp149785
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥97%(SDS-PAGE&HPLC)
Expression System
E. coli
Accession #
P01270
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Fully biologically active when compared to standard. The ED50 as determined by its ability to induce cAMP accumulation in murine MC3T3E1 cells is less than 50 ng/ml, corresponding to a specific activity of > 2.0 × 104 IU/mg.
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp149785-10μg
2
$159.90
50μg
rp149785-50μg
1
$479.90
100μg
rp149785-100μg
1
$735.90
1mg
rp149785-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$4,787.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,Azide Free,High Performance,PBS Only,≥97%(SDS-PAGE&HPLC) ActiBioPure™,Animal Free,Azide Free,Bioactive,Carrier Free,High Performance,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human Parathyroid Hormone Protein, >97% (SDS-PAGE&HPLC)
Synonyms
hPTH | Parathormone | Parathyrin | Parathyroid hormone | Parathyroid hormone 1 | Prepro PTH | Preproparathyroid hormone | PTH | PTH1 | PTH1 receptor | PTH1R | PTHR | PTHR1 | PTHY_HUMAN | Parathormone | Parathyrin | PTH
Grade
ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance, PBS Only
Specifications & Purity
Animal Free, Carrier Free, Bioactive, ActiBioPure™, Azide Free, High Performance, PBS Only, ≥97%(SDS-PAGE&HPLC)
Biochemical and Physiological Mechanisms
PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion. Stimulates [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblastic cells.
Purity
>97% (SDS-PAGE&HPLC)
Bioactivity
Fully biologically active when compared to standard. The ED50 as determined by its ability to induce cAMP accumulation in murine MC3T3E1 cells is less than 50 ng/ml, corresponding to a specific activity of > 2.0 × 104 IU/mg.
Endotoxin Concentration
<1.0 EU/μg
Expression System
E. coli
Species
Human
Amino Acids
32-115 aa
Sequence
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ
Protein Tag
No tag
Accession #
Predicted molecular weight
9.4 kDa
SDS-PAGE
9.4 kDa
Molecule Type
Protein
Storage and Shipping
Shape
Lyophilized
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 3 months, -20 to -70 °C under sterile conditions after reconstitution. Upon receipt, it is recommended to aliquot. Avoid freeze/th
Images

Recombinant Human Parathyroid Hormone Protein (rp149785) - Protein Bioactivity
Fully biologically active when compared to standard. The ED₅₀ as determined by its ability to induce cAMP accumulation in murine MC3T3E1 cells is less than 50 ng/mL, corresponding to a specific activity of > 2.0 × 10⁴ IU/mg.

Recombinant Human Parathyroid Hormone Protein (rp149785) - SDS-PAGE
Recombinant Human Parathyroid Hormone Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 9.4 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDateItem
ZJ23F1001337Certificate of AnalysisMar 17, 2026 rp149785
ZJ23F1001338Certificate of AnalysisMar 17, 2026 rp149785
ZJ23F1001339Certificate of AnalysisMar 17, 2026 rp149785
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.