Recombinant Mouse FGF-21 Protein, >96%(SDS-PAGE, HPLC)

Cat. No.: rp153970
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥96%(SDS-PAGE&HPLC)
Expression System
E.coli
Accession #
Q9JJN1
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<0.1 EU/μg
Bioactivity
Fully biologically active when compared to standard. The ED₅₀ as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 0.5 μg/ml, corresponding to a specific activity of >2.0 ×10³IU/mg in the presence of 5 µg/ml of rMuβ-Klotho and 10 μg/ml of heparin.
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
5μg
rp153970-5μg
9
$89.90
50μg
rp153970-50μg
8

$342.90

$399.90
Save $57.00 (14.25%)
1mg
rp153970-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$3,399.90
500μg
rp153970-500μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$1,999.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,Azide Free,High Performance,PBS Only,≥96%(SDS-PAGE&HPLC) ActiBioPure™,Animal Free,Azide Free,Bioactive,Carrier Free,High Performance,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

Fibroblast growth factor-21 (FGF-21) belongs to the large FGF family and it is specifically induced by HMGCS2 activity. In mice, brown adipose tissue becomes a source of systemic FGF21 after cold exposure. FGF-21 stimulates glucose uptake in differentiated adipocytes via the induction of glucose transporter SLC2A1/GLUT1 expression and the activity depends on the presence of KLB. FGF-21, in the presence of β-Klotho as a protein cofactor, signals through the FGFR 1c and 4 receptors. Murine FGF-21 shows limited binding to heparin. In addition, Murine FGF-21 respectively shows 81% and 92% a.a. identity to human and rat FGF-21, and it show activity on human and rat cells. Recombinant Murine FGF21 is a 19.9kDa globular protein containing 182 amino acid residues.

Purity

>96%(SDS-PAGE, HPLC)


Additional sequence information

A single non-glycosylated polypeptide chain containing 182 amino acids. This product is for the mature full length protein. The signal peptide is not included.


Function

Stimulates glucose uptake in differentiated adipocytes via the induction of glucose transporter SLC2A1/GLUT1 expression (but not SLC2A4/GLUT4 expression). Activity requires the presence of KLB.

Specifications

Product Name
Recombinant Mouse FGF-21 Protein, >96%(SDS-PAGE, HPLC)
Synonyms
FGF21 | FGF-21 | fibroblast growth factor 21 | FGF 21 | FGF21_HUMAN | FGFL | PRO10196 | UNQ3115 | Fgf8c
Grade
ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance, PBS Only
Specifications & Purity
Animal Free, Carrier Free, Bioactive, ActiBioPure™, Azide Free, High Performance, PBS Only, ≥96%(SDS-PAGE&HPLC)
Purity
>96%(SDS-PAGE, HPLC)
Bioactivity
Fully biologically active when compared to standard. The ED₅₀ as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 0.5 μg/ml, corresponding to a specific activity of >2.0 ×10³IU/mg in the presence of 5 µg/ml of rMuβ-Klotho and 10 μg/ml of heparin.
Endotoxin Concentration
<0.1 EU/μg
Expression System
E.coli
Species
Mouse
Amino Acids
29-210 aa
Sequence
AYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTVVGAAHRS PESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFREL LLEDGYNVYQSEAHGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEP QDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS
Protein Tag
No tag
Accession #
Predicted molecular weight
19.9 kDa
Molecule Type
Protein
Storage and Shipping
Shape
Lyophilized
Reconstitution
This vial must be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in a sterile aqueous buffer to an appropriate concentration. Stock solutions should be apportioned into working aliquots and stored at ≤-20℃. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon receipt, it is recommended to aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. pH: 7.40 Constituent: 100% PBS Lyophilized from a 0.2 µm filtered concentrated solution in 3 脳 PBS. This
Images

Recombinant Mouse FGF-21 Protein (rp153970) - Protein Bioactivity
Fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 0.5 μg/mL, corresponding to a specific activity of > 2.0 X 10³ IU/mg in the presence of 5.0 µg/mL of rMuβ-Klotho and 10.0 μg/mL of heparin.

Recombinant Mouse FGF-21 Protein (rp153970) - SDS-PAGE
3 μg/lane of Recombinant Mouse FGF-21 was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 21.1 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

2 results found

Lot NumberCertificate TypeDateItem
ZJ23F1101656Certificate of AnalysisNov 20, 2023 rp153970
ZJ23F1101655Certificate of AnalysisNov 20, 2023 rp153970
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.