Recombinant Human GM-CSF Protein

Cat. No.: rp156011

GRADE & PURITY Carrier Free, Bioactive, High Performance, His Tag, PBS Only, ≥95%(SDS-PAGE)

Expression System

E. coli

Accession #

P04141

Protein Tag

N-His

Expression system

E. coli

Endotoxin Concentration

<1.0 EU/μg

Bioactivity

Measured in a cell proliferation assay using TF-1 cells. The ED50 for this effect is typically 0.82 ng/mL.

Overview

Purity:≥95%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description：
GM CSF was initially characterized as a factor that can support the in vitro colony formation of granulocyte macrophage progenitors. It is also a growth factor for erythroid, megakaryocyte, and eosinophil progenitors. GM CSF is produced by a number of different cell types (including T cells, B cells, macrophages, mast cells, endothelial cells, fibroblasts, and adipocytes) in response to cytokine or inflammatory stimuli. On mature hematopoietic cells, GM CSF is a survival factor for and activates the effector functions of granulocytes, monocytes/macrophages, and eosinophils. GM CSF promotes a Th1 biased immune response, angiogenesis, allergic inflammation, and the development of autoimmunity. It shows clinical effectiveness in ameliorating chemotherapy induced neutropenia, and GM CSF transfected tumor cells are utilized as cancer vaccines. The 22 kDa glycosylated GM CSF, similar to IL 3 and IL 5, is a cytokine with a core of four bundled alpha -helices. Mature human GM CSF shares 63% 70% amino acid sequence identity with canine, feline, porcine, and rat GM CSF and 54% with mouse GM CSF. GM CSF exerts its biological effects through a heterodimeric receptor complex composed of GM CSF R alpha /CD116 and the signal transducing common beta chain (CD131) which is also a component of the high affinity receptors for IL 3 and IL 5. In addition, GM CSF binds a naturally occurring soluble form of GM CSF R alpha. Human GM CSF is active on canine and feline cells but not on murine cells.

Specifications

Product Name

Recombinant Human GM-CSF Protein

Synonyms

Molgramostim | molgramostin | Sargramostim | colony stimulating factor 2 (granulocyte-macrophage) | Colony-stimulating factor | CSF | CSF2 | CSF-2 | GMCSF | GM-CSF | GMCSFgranulocyte-macrophage colony-stimulating factor | granulocyte-macrophage colony sti

Grade

Bioactive, Carrier Free, High Performance, His Tag, PBS Only

Specifications & Purity

Carrier Free, Bioactive, High Performance, His Tag, PBS Only, ≥95%(SDS-PAGE)

Bioactivity

Measured in a cell proliferation assay using TF-1 cells. The ED50 for this effect is typically 0.82 ng/mL.

Endotoxin Concentration

<1.0 EU/μg

Expression System

E. coli

Amino Acids

18-144 aa

Sequence

MGSSHHHHHHSSGLVPRGSHMAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVISEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITFESFKENLKDFLLVIPFDCWEPVQE

Protein Tag

N-His

Accession #

P04141

Predicted molecular weight

16.8 kDa

SDS-PAGE

14.8 kDa, under reducing conditions; 14.8 kDa, under non-reducing condition

Molecule Type

Protein

Storage and Shipping

Shape

Lyophilized

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.

Storage

Store at -20°C,Avoid repeated freezing and thawing

Shipped In

Ice chest + Ice pads

Stability And Storage

Store at -20°C for 1 year. Avoid freeze / thaw cycle.

Images

Protein Bioactivity: Recombinant Human GM-CSF Protein (rp156011)

Recombinant Human GM-CSF Protein (rp156011) - Protein Bioactivity
Measured in a cell proliferation assay using TF-1 cells. The ED₅₀ for this effect is typically 0.82 ng/mL.

SDS-PAGE: Recombinant Human GM-CSF Protein (rp156011)

Recombinant Human GM-CSF Protein (rp156011) - SDS-PAGE
3 μg/lane of Recombinant Human GM-CSF Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 14.8 kDa.

ELISA: Recombinant Human GM-CSF Protein (rp156011)

Recombinant Human GM-CSF Protein (rp156011) - ELISA
Immobilized Recombinant Human GM-CSF Protein (rp156011) at 1.0 μg/mL can bind Namilumab (anti-GM-CSF) (Ab175608) with the EC50 of 62.67 ng/mL.

ELISA: Recombinant Human GM-CSF Protein (rp156011)

Recombinant Human GM-CSF Protein (rp156011) - ELISA
Immobilized Recombinant Human GM-CSF Protein (rp156011) at 1.0 μg/mL can bind Gimsilumab (anti-GM-CSF) (Ab175548) with the EC50 of 23.52 ng/mL.