Recombinant Rat IL-6 Protein, >96% (SDS-PAGE, HPLC)

Cat. No.: rp155124
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥96%(SDS-PAGE&HPLC)
Expression System
E.coli
Accession #
P20607
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<0.1 EU/μg
Bioactivity
1. Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using IL-6-dependent murine 7TD1 cells is less than 0.01 ng/mL, corresponding to a specific activity of >1.0 ×108 IU/mg. 2. Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED50 for this effect is less than 10 ng/mL.
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp155124-10μg
2

$107.90

$199.90
Save $92.00 (46.02%)
50μg
rp155124-50μg
1

$372.90

$699.90
Save $327.00 (46.72%)
100μg
rp155124-100μg
1

$651.90

$1,269.90
Save $618.00 (48.67%)
1mg
rp155124-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$4,449.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,Azide Free,High Performance,PBS Only,≥96%(SDS-PAGE&HPLC) ActiBioPure™,Animal Free,Azide Free,Bioactive,Carrier Free,High Performance,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -80°C Ships Dry ice packs + Cold packs Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

Interleukin-6 (IL-6) is encoded by the IL-6 gene and acts as both a pro-inflammatory and anti-inflammatory cytokine. IL-6 is a pleiotropic cytokine that plays an important role in host defense by regulating immune and inflammatory responses. Produced by T cells, monocytes, fibroblasts, endothelial cells and keratinocytes, IL-6 has diverse biological functions. It stimulates B cell differentiation and antibody production, synergizes with IL-3 in megakaryocyte development and platelet production, induces expression of hepatic acute-phase proteins, and regulates bone metabolism. IL-6 signals through the IL-6 receptor system that consists of two chains, IL-6R α and gp130. Murine IL-6 is inactive on human cells, while both human and murine are equally active on murine cells. Recombinant Rat IL-6 is a 21.7kDa protein containing 187 amino acid residues.


Purity

>96% SDS-PAGE


Function

Cytokine with a wide variety of biological functions. It is a potent inducer of the acute phase response. Plays an essential role in the final differentiation of B-cells into Ig-secreting cells Involved in lymphocyte and monocyte differentiation. It induces myeloma and plasmacytoma growth and induces nerve cells differentiation Acts on B-cells, T-cells, hepatocytes, hematopoeitic progenitor cells and cells of the CNS. Also acts as a myokine. It is discharged into the bloodstream after muscle contraction and acts to increase the breakdown of fats and to improve insulin resistance.


Specifications

Product Name
Recombinant Rat IL-6 Protein, >96% (SDS-PAGE, HPLC)
Synonyms
B-cell differentiation factor | B-cell stimulatory factor 2 | BSF2 | BSF-2 | CDF | CTL differentiation factor | hybridoma growth factor | MGI-2A | Interleukin BSF 2 | Cytotoxic T cell differentiation factor | Hepatocyte stimulating factor | Hepatocyte sti
Grade
ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance, PBS Only
Specifications & Purity
Animal Free, Carrier Free, Bioactive, ActiBioPure™, Azide Free, High Performance, PBS Only, ≥96%(SDS-PAGE&HPLC)
Purity
>96% (SDS-PAGE, HPLC)
Bioactivity
1. Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using IL-6-dependent murine 7TD1 cells is less than 0.01 ng/mL, corresponding to a specific activity of >1.0 ×108 IU/mg. 2. Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED50 for this effect is less than 10 ng/mL.
Endotoxin Concentration
<0.1 EU/μg
Expression System
E.coli
Species
Rat
Amino Acids
25-211 aa
Sequence
FPTSQVRRGDFTEDTTHNRPVYTTSQVGGLITYVLREILEMRKELCNGN SDCMNSDDALSENNLKLPEIQRNDGCFQTGYNQEICLLKICSGLLEFRFY LEFVKNNLQDNKKDKARVIQSNTETLVHIFKQEIKDSYKIVLPTPTSNAL LMEKLESQKEWLRTKTIQLILKALEEFLKVTMRSTRQT
Protein Tag
No tag
Accession #
Predicted molecular weight
21.7 kDa
SDS-PAGE
20.9 kDa, under reducing conditions; 19.1 kDa, under non-reducing conditions.
Molecule Type
Protein
Storage and Shipping
Shape
Lyophilized
Reconstitution
This vial must be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in a sterile aqueous buffer to an appropriate concentration. Stock solutions should be apportioned into working aliquots and stored at ≤-20℃. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -80°C
Shipped In
Dry ice packs + Cold packs
Stability And Storage
Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.
Images

Recombinant Rat IL-6 Protein (rp155124) - Protein Bioactivity
Fully biologically active when compared to standard. The ED₅₀ as determined by a cell proliferation assay using IL-6-dependent murine 7TD1 cells is less than 0.01 ng/mL, corresponding to a specific activity of >1.0 ×10⁸ IU/mg.

Recombinant Rat IL-6 Protein (rp155124) - Protein Bioactivity
Measured in a cell proliferation assay using TF‑1 human erythroleukemic cells. The ED₅₀ for this effect is less than 10 ng/mL.

Recombinant Rat IL-6 Protein (rp155124)- SDS-PAGE
2.5 μg/lane of Recombinant Rat IL-6 was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 20.9 kDa under reducing conditions and 19.1 kDa under non-reducing conditions.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDateItem
ZJ23F0901077Certificate of AnalysisSep 18, 2023 rp155124
ZJ23F0901076Certificate of AnalysisSep 18, 2023 rp155124
ZJ23F0901075Certificate of AnalysisSep 18, 2023 rp155124
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.