Recombinant Human Leptin Protein

Cat. No.: rp170412
AVAILABLE TO ORDER
GRADE & PURITY Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE)
Expression System
E. coli
Accession #
Q6NT58
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Immobilized Recombinant Human Leptin Receptor Protein (rp184128) at 2.0 μg/mL can bind Recombinant Human Leptin Protein (rp170412) with the EC50 of 6.6 ng/mL.
Size
Status
Price
Qty
100μg
rp170412-100μg
10
$99.90
1mg
rp170412-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$379.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Carrier Free,Bioactive,ActiBioPure™,PBS Only,≥95%(SDS-PAGE) ActiBioPure™,Bioactive,Carrier Free,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

Purity: ≥95%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description:
Leptin is a protein product of the mouse obese gene. Mice with mutations in the obese gene that block the sythesis of Leptin have been found to be obese, diabetic and to have reduced activity, metabolism and body temperature. cDNA clones encoding Leptin have been isolated from human, simian, mouse and rat cells. Human Leptin shares approximately 84% sequence identity with the mouse protein. Human Leptin cDNA encodes a 167 amino acid residue protein with a 21 amino acid residue signal sequence that is cleaved to yield the 146 amino acid residue mature protein. The expression of Leptin mRNA has been shown to be restricted to adipose tissue.
A high-affinity receptor for Leptin (OB-R) with homology to gp130 and the G-CSF receptor has been cloned. OB-R mRNA has been shown to be expressed in the choroid plexus and in the hypothalamus. OB-R has also been identified as an isoform of B219, a sequence that is expressed in at least four isoforms in very primitive hematopoietic cell populations and in a variety of lymphohematopoietic cell lines. The roles of leptin in body weight regulation, hematopoiesis and reproduction continue to be investigated.

Specifications

Product Name
Recombinant Human Leptin Protein
Synonyms
FLJ94114 | LEP | leptin (murine obesity homolog) | leptin (obesity homolog, mouse) | Leptin | OB | Obese protein | obese, mouse, homolog of | Obesity factor | OBOBS
Grade
ActiBioPure™, Bioactive, Carrier Free, PBS Only
Specifications & Purity
Carrier Free, Bioactive, ActiBioPure™, PBS Only, ≥95%(SDS-PAGE)
Bioactivity
Immobilized Recombinant Human Leptin Receptor Protein (rp184128) at 2.0 μg/mL can bind Recombinant Human Leptin Protein (rp170412) with the EC50 of 6.6 ng/mL.
Endotoxin Concentration
<1.0 EU/μg
Expression System
E. coli
Amino Acids
22-167 aa
Sequence
VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC
Protein Tag
No tag
Accession #
Predicted molecular weight
16.0 kDa
SDS-PAGE
12.6 kDa, under reducing conditions
Note
This product can replace rp148245
Molecule Type
Protein
Storage and Shipping
Shape
Lyophilized
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 1.0 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20°C for 1 year. Avoid freeze / thaw cycle.
Images

Recombinant Human Leptin Protein (rp170412) - SDS-PAGE
3 μg/lane of Recombinant Human Leptin Protein was resolved with SDS-PAGE under reducing (R) conditions and visualized by Coomassie® Blue staining, showing a band at 12.6 kDa under reducing conditions.

Recombinant Human Leptin Protein (rp170412) - Binding Activity
Immobilized Recombinant Human Leptin Receptor Protein (rp184128) at 2.0 μg/mL can bind Recombinant Human Leptin Protein (rp170412) with the EC50 of 6.6 ng/mL.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

1 results found

Lot NumberCertificate TypeDateItem
ZJ24F0606780Certificate of AnalysisJun 14, 2024 rp170412
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.