Recombinant Human SDF1 Protein, >95% SDS-PAGE

Cat. No.: rp151342
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. His Tag ? His tag grade — recombinant protein bearing a His tag for affinity purification/detection. Use to purify, immobilize, or detect the tagged protein. ≥95%(SDS-PAGE)
Expression System
E. coli
Accession #
P48061
Protein Tag
N-His
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Fully biologically active determined by the dose dependant migration of THP-1 cells. The optimum chemotaxis of SDF1 occurs at 10-60 ng/mL.
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp151342-10μg
5
$143.90
50μg
rp151342-50μg
1
$399.90
100μg
rp151342-100μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$699.90
1mg
rp151342-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$3,999.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,Azide Free,High Performance,His-Tag,≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Azide Free,Bioactive,Carrier Free,High Performance,His Tag for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

Purity

>95% SDS-PAGE.


Additional sequence information

Mature chain SDF1 alph


Function

Chemoattractant active on T-lymphocytes, monocytes, but not neutrophils. Activates the C-X-C chemokine receptor CXCR4 to induce a rapid and transient rise in the level of intracellular calcium ions and chemotaxis. Also binds to atypical chemokine receptor ACKR3, which activates the beta-arrestin pathway and acts as a scavenger receptor for SDF-1. SDF-1-beta(3-72) and SDF-1-alpha(3-67) show a reduced chemotactic activity. Binding to cell surface proteoglycans seems to inhibit formation of SDF-1-alpha(3-67) and thus to preserve activity on local sites. Acts as a positive regulator of monocyte migration and a negative regulator of monocyte adhesion via the LYN kinase. Stimulates migration of monocytes and T-lymphocytes through its receptors, CXCR4 and ACKR3, and decreases monocyte adherence to surfaces coated with ICAM-1, a ligand for beta-2 integrins. SDF1A/CXCR4 signaling axis inhibits beta-2 integrin LFA-1 mediated adhesion of monocytes to ICAM-1 through LYN kinase. Inhibits CXCR4-mediated infection by T-cell line-adapted HIV-1. Plays a protective role after myocardial infarction. Induces down-regulation and internalization of ACKR3 expressed in various cells. Has several critical functions during embryonic development; required for B-cell lymphopoiesis, myelopoiesis in bone marrow and heart ventricular septum formation.


Post-translational

Processed forms SDF-1-beta(3-72) and SDF-1-alpha(3-67) are produced after secretion by proteolytic cleavage of isoforms Beta and Alpha, respectively. The N-terminal processing is probably achieved by DPP4. Isoform Alpha is first cleaved at the C-terminus to yield a SDF-1-alpha(1-67) intermediate before being processed at the N-terminus. The C-terminal processing of isoform Alpha is reduced by binding to heparin and, probably, cell surface proteoglycans.

Specifications

Product Name
Recombinant Human SDF1 Protein, >95% SDS-PAGE
Synonyms
C-X-C motif chemokine 12 | hIRH | hSDF-1 | Intercrine reduced in hepatomas | IRH | PBSF | Pre-B cell growth-stimulating factor | SDF-1
Grade
ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance, His Tag
Specifications & Purity
Animal Free, Carrier Free, Bioactive, ActiBioPure™, Azide Free, High Performance, His-Tag, ≥95%(SDS-PAGE)
Purity
>95% SDS-PAGE
Bioactivity
Fully biologically active determined by the dose dependant migration of THP-1 cells. The optimum chemotaxis of SDF1 occurs at 10-60 ng/mL.
Endotoxin Concentration
<1.0 EU/μg
Expression System
E. coli
Species
Human
Amino Acids
23-89 aa
Sequence
PVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
Protein Tag
N-His
Accession #
Predicted molecular weight
9.1kDa
SDS-PAGE
9.9 kDa, under reducing conditions; 9.9 kDa, under non-reducing conditions.
Molecule Type
Protein
Storage and Shipping
Shape
Lyophilized
Reconstitution
Reconstitute in10 mM PBS (pH7.4) to a concentration of 0.1-1.0mg/mL. Do not vortex.
Storage
Store at -20°C
Shipped In
Ice chest + Ice pads
Stability And Storage
Avoid repeated freeze/thaw cycles. Store at 2-8℃ for one month. Aliquot and store at -80℃ for 12 months.
Images

Recombinant Human SDF1 Protein (rp151342) - Protein Bioactivity
Fully biologically active determined by the dose dependant migration of THP-1 cells. The optimum chemotaxis of SDF1 occurs at 10-60 ng/mL.

Recombinant Human SDF1 Protein (rp151342) - SDS-PAGE
2.5 μg/lane of Recombinant Human SDF1 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 9.9 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

6 results found

Lot NumberCertificate TypeDateItem
ZJ25F0723971Certificate of AnalysisMay 20, 2026 rp151342
ZJ25F0723972Certificate of AnalysisMay 20, 2026 rp151342
ZJ25F0723973Certificate of AnalysisMay 20, 2026 rp151342
ZJ23F0600466Certificate of AnalysisDec 17, 2025 rp151342
ZJ23F0600467Certificate of AnalysisDec 17, 2025 rp151342
ZJ23F0600468Certificate of AnalysisDec 17, 2025 rp151342
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.