Recombinant Human EGF Protein, >95% SDS-PAGE, CAS No.62253-63-8

CAS: 62253-63-8 Cat. No.: rp145392 Molecular Weight: 6.5kD EC Number: 810-845-4 PubChem CID: 16143379
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥95%(SDS-PAGE)
Expression System
Pichia pastoris
Accession #
P01133
Protein Tag
No tag
Expression system
Pichia pastoris
Endotoxin Concentration
<0.2 EU/μg
Bioactivity
Measured in a cell proliferation assay using BALB/3T3 mouse embryo fibroblasts cell line. The ED₅₀ for this effect is typically <0.9 ng/mL.
Size
Status
Price
Qty
100μg
rp145392-100μg
7
$99.90
1mg
rp145392-1mg
8
$399.90
500μg
rp145392-500μg
10
$299.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,PBS Only,≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Bioactive,Carrier Free,High Performance,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 8 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human EGF Protein, >95% SDS-PAGE, CAS No.62253-63-8
Synonyms
beta-urogastrone | EGF | epidermal growth factor (beta-urogastrone) | epidermal growth factor | hEGF | HOMG4 | pro-epidermal growth factor | URG | Urogastrone | EGF
Grade
ActiBioPure™, Animal Free, Bioactive, Carrier Free, High Performance, PBS Only
Specifications & Purity
Animal Free, Carrier Free, Bioactive, ActiBioPure™, High Performance, PBS Only, ≥95%(SDS-PAGE)
Biochemical and Physiological Mechanisms
EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR
Purity
>95% SDS-PAGE
Bioactivity
Measured in a cell proliferation assay using BALB/3T3 mouse embryo fibroblasts cell line. The ED₅₀ for this effect is typically <0.9 ng/mL.
Endotoxin Concentration
<0.2 EU/μg
Expression System
Pichia pastoris
Species
Human
Amino Acids
971-1021 aa
Sequence
NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWE
Protein Tag
No tag
Protein Length
Full length protein
Accession #
Source
Recombinant
Predicted molecular weight
6 kDa
CAS
62253-63-8
Molecule Type
Protein
Storage and Shipping
Shape
Lyophilized
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile 10mM PBS to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 ℃. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at 2-8℃ short term (4 weeks). Store at -20℃ long term (24 months). Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle.
Images

Recombinant Human EGF Protein (rp145392)-Protein Bioactivity
Measured in a cell proliferation assay using BALB/3T3 mouse embryo fibroblasts cell line. The ED₅₀ for this effect is typically <0.9ng/mL.

Recombinant Human EGF Protein (rp145392)-SDS-PAGE
5μg/lane of Recombinant Human EGF was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a single band at 6.6 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Taxonomic Classification

Taxonomy Tree

KingdomOrganic compounds
SuperclassOrganic Polymers
ClassPolypeptides
SubclassNot available
Intermediate Tree Nodes Not available
Direct ParentPolypeptides
Alternative Parents Peptides  Tyrosine and derivatives  Arginine and derivatives  Phenylalanine and derivatives  Histidine and derivatives  Glutamic acid and derivatives  Glutamine and derivatives  Asparagine and derivatives  Aspartic acid and derivatives  Isoleucine and derivatives  Leucine and derivatives  Methionine and derivatives  N-acyl-L-alpha-amino acids  Valine and derivatives  Proline and derivatives  Serine and derivatives  Cysteine and derivatives  Tryptamines and derivatives  Alpha amino acid amides  Alanine and derivatives  3-alkylindoles  Amphetamines and derivatives  N-acylpyrrolidines  Pyrrolidinecarboxamides  1-hydroxy-2-unsubstituted benzenoids  Substituted pyrroles  N-acyl amines  Tertiary carboxylic acid amides  Heteroaromatic compounds  Imidazoles  Guanidines  Secondary carboxylic acid amides  Primary carboxylic acid amides  Amino acids  Carboximidamides  Carboxylic acids  Dialkylthioethers  Sulfenyl compounds  Alkylthiols  Azacyclic compounds  Carbonyl compounds  Hydrocarbon derivatives  Imines  Monoalkylamines  Organic oxides  Primary alcohols  
Molecular FrameworkAromatic heteropolycyclic compounds
Substituents Polypeptide - Alpha peptide - Tyrosine or derivatives - Arginine or derivatives - Phenylalanine or derivatives - Histidine or derivatives - Glutamic acid or derivatives - Glutamine or derivatives - Methionine or derivatives - Asparagine or derivatives - Aspartic acid or derivatives - Leucine or derivatives - Isoleucine or derivatives - N-acyl-l-alpha-amino acid - N-acyl-alpha amino acid or derivatives - N-acyl-alpha-amino acid - Valine or derivatives - Proline or derivatives - Triptan - Alpha-amino acid amide - Serine or derivatives - Cysteine or derivatives - Alanine or derivatives - 3-alkylindole - Amphetamine or derivatives - N-substituted-alpha-amino acid - Alpha-amino acid or derivatives - Indole - Indole or derivatives - N-acylpyrrolidine - Pyrrolidine carboxylic acid or derivatives - Pyrrolidine-2-carboxamide - 1-hydroxy-2-unsubstituted benzenoid - Phenol - Benzenoid - Fatty acyl - Monocyclic benzene moiety - Fatty amide - Substituted pyrrole - N-acyl-amine - Pyrrolidine - Pyrrole - Imidazole - Tertiary carboxylic acid amide - Heteroaromatic compound - Azole - Amino acid or derivatives - Carboxamide group - Guanidine - Secondary carboxylic acid amide - Primary carboxylic acid amide - Amino acid - Dialkylthioether - Carboximidamide - Azacycle - Organoheterocyclic compound - Carboxylic acid derivative - Carboxylic acid - Thioether - Sulfenyl compound - Alkylthiol - Hydrocarbon derivative - Primary amine - Organonitrogen compound - Carbonyl group - Organooxygen compound - Organosulfur compound - Primary alcohol - Organic nitrogen compound - Organic oxide - Imine - Alcohol - Primary aliphatic amine - Organic oxygen compound - Amine - Aromatic heteropolycyclic compound
DescriptionThis compound belongs to the class of organic compounds known as polypeptides. These are peptides containing ten or more amino acid residues.
External Descriptors Not available
Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDateItem
ZJ23F0400094Certificate of AnalysisApr 25, 2023 rp145392
ZJ23F0400095Certificate of AnalysisApr 25, 2023 rp145392
ZJ23F0400093Certificate of AnalysisApr 19, 2023 rp145392
Documents & Articles
Citations of This Product
References
1. Xiaoli Lu, Shangwen Sun, Na Li, Shuying Hu, Yuyao Pan, Lin Wang, Xuefeng Zhou, Hanbang Chen, Feimin Zhang.  (2024)  Janus sponge/electrospun fibre composite combined with EGF/bFGF/CHX promotes reconstruction in oral tissue regeneration.  COLLOIDS AND SURFACES B-BIOINTERFACES,      [PMID:39084056] [10.1016/j.colsurfb.2024.114117]
2. Zhang Jie, Chen Weiwu, Zhang Chen, He Qian, Wang Xudong, Han Jiayu, Gao Peng, Wang Kunyu, Xie Haoze, Gao Feng, Guo Yining, Guo Wenhao, Jiang Haofei, Le Jing, Zang Ruichen, Mo Sisi, Fan Haobo, Zhu Xiaoxiao, Jiang Xinrong, Gao Fengbin, Yu Yanlan, Ding Guoqing, Chen Yicheng.  (2025)  Prostate Cancer Cells Secrete PD-1 in Exosomes to Enhance Myeloid-Derived Suppressor Cell Activity and Promote Tumor Immune Evasion.  CANCER RESEARCH,      [PMID:40698651] [10.1158/0008-5472.CAN-24-3748]
3. Cao Mingbo, Ren Yupeng, Li Yuxuan, Deng Junfeng, Su Xiaorui, Tang Yongchang, Yuan Feng, Deng Haixia, Yang Gaoyuan, He Zhiwei, Liu Bo, Yao Zhicheng, Deng Meihai.  (2023)  Lnc-ZEB2-19 Inhibits the Progression and Lenvatinib Resistance of Hepatocellular Carcinoma by Attenuating the NF-κB Signaling Pathway through the TRA2A/RSPH14 Axis.  International Journal of Biological Sciences,  19  (12): (3678-3693).  [PMID:37564197] [10.7150/ijbs.85270]
4. Maoze Guo, Yuqiu Wang, Bingbing Gao, Bingfang He.  (2021)  Shark Tooth-Inspired Microneedle Dressing for Intelligent Wound Management.  ACS Nano,      [PMID:34533924] [10.1021/acsnano.1c06279]
5. Yang Min, Ma Yuejiang, Cao Zhu, Zhan Hong, Jin Ye, Huang Xiufeng, Yang Shizhou.  (2025)  HPV16 E7 Enhances Cell Stemness via RTKN2-Mediated Activation of the NF-κB Pathway in Cervical Cancer.  BIOCHEMICAL GENETICS,      [PMID:40495058] [10.1007/s10528-025-11144-w]
6. Xiaoshen Zhang, Tao Jiang, Lingyun Ye, Jianguo Sun, Lei Wang, Juanjuan Li, Fengying Wu, Shengxiang Ren, Guanghui Gao.  (2025)  WISP3 upregulates SDCBP expression to promote the progression of non-small cell lung cancer via the TGF-β signaling pathway.  BIOCHEMICAL PHARMACOLOGY,      [PMID:40571215] [10.1016/j.bcp.2025.117082]
7. Yang Shizhou, Wu Tingting, Cao Zhu, Chen Zhengyun, Ma Yuejiang, Wang Ting, Qian Linhua, Huang Xiufeng.  (2026)  Hypoxic glycolysis-driven histone lactylation activates NHE7 to promote endometrial cancer progression via COX6C-mediated endoplasmic reticulum stress.  APOPTOSIS,  31  (2): (55).  [PMID:41575611] [10.1007/s10495-026-02262-w]
8. Yunxia Du, Di Xiao, Changle Ren, Zhenlan Li, Xiaofeng Wang, Yantao Zhao, Yongmei Jiang.  (2026)  pH-responsive polydopamine-shelled 3D-printed chitosan/collagen hydrogel integrating exosomes and an enzyme/peptide cascade for diabetic wound healing.  Biomaterials Science,      [PMID:41685930] [10.1039/D5BM01823D]
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.