Recombinant Rat GM-CSF Protein, >98% (SDS-PAGE, HPLC)

Cat. No.: rp155067
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. PBS Only ? PBS-only formulation — supplied in phosphate-buffered saline with no other additives. Use when you need a clean PBS buffer free of stabilizers/carriers. ≥98%(SDS-PAGE&HPLC)
Expression System
E.coli
Accession #
P48750
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<0.01 EU/μg
Bioactivity
Measured in a cell proliferation assay using murine FDC-P1 cells. The ED50 for this effect is typically <0.02 ng/mL.
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp155067-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$89.90
50μg
rp155067-50μg
2
$249.90
1mg
rp155067-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$3,339.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,Azide Free,High Performance,PBS Only,≥98%(SDS-PAGE&HPLC) ActiBioPure™,Animal Free,Azide Free,Bioactive,Carrier Free,High Performance,PBS Only for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

Purity

>98% SDS-PAGE. > 98 % by HPLC.


Additional sequence information

This product is for the mature full length protein. The signal peptide is not included.


Function

Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes.


Background

GM-CSF is a hematopoietic growth factor that stimulates the development of neutrophils and macrophages, and promotes the proliferation and development of early erythroid megakaryocytic and eosinophilic progenitor cells. It is produced by endothelial cells, monocytes, fibroblasts and T-lymphocytes. GM-CSF inhibits neutrophil migration and enhances the functional activity of the mature end-cells. GM-CSF has also been reported to have a functional role on non-hematopoietic cells and can induce human endothelial cells to migrate and proliferate. Additionally, it can stimulate the proliferation of a number of tumor cell lines, including osteogenic sarcoma, carcinoma and adenocarcinoma cell lines. It is reported that GM-CSF has no biological effects across species. Recombinant Rat GM-CSF is a 14.5kDa globular protein consisting of 127 amino acid residues.


Specifications

Product Name
Recombinant Rat GM-CSF Protein, >98% (SDS-PAGE, HPLC)
Synonyms
Colony stimulating factor 2 (granulocyte-macrophage) | Colony-stimulating factor | CSF | CSF2 | CSF-2 | GMCSF | GM-CSF | granulocyte-macrophage colony-stimulating factor | granulocyte-macrophage colony stimulating factor | MGC131935 | MGC138897 | Molgramo
Grade
ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance, PBS Only
Specifications & Purity
Animal Free, Carrier Free, Bioactive, ActiBioPure™, Azide Free, High Performance, PBS Only, ≥98%(SDS-PAGE&HPLC)
Purity
>98% (SDS-PAGE, HPLC)
Bioactivity
Measured in a cell proliferation assay using murine FDC-P1 cells. The ED50 for this effect is typically <0.02 ng/mL.
Endotoxin Concentration
<0.01 EU/μg
Expression System
E.coli
Species
Rat
Amino Acids
18-144 aa
Sequence
APTRSPNPVTRPWKHVDAIKEALSLLNDMRALENEKNEDVDIISNEFSI QRPTCVQTRLKLYKQGLRGNLTKLNGALTMIASHYQTNCPPTPETDCE IEVTTFEDFIKNLKGFLFDIPFDCWKPVQK
Protein Tag
No tag
Protein Length
Full length protein
Accession #
Source
Recombinant
Predicted molecular weight
14.5 kDa
SDS-PAGE
13.7 kDa, under reducing conditions; 13.7 kDa, under non-reducing conditions.
Molecule Type
Protein
Storage and Shipping
Shape
Lyophilized
Reconstitution
1.This vial must be briefly centrifuged prior to opening to bring the contents to the bottom. 2. Reconstitute in a sterile aqueous buffer to an appropriate concentration. Stock solutions should be apportioned into working aliquots and stored at ≤ -20°C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Upon receipt, it is recommended to aliquot. Store at -20°C, Avoid freeze / thaw cycles.
Images

Recombinant Rat GM-CSF Protein (rp155067)-Protein Bioactivity
Measured in a cell proliferation assay using FDC-P1 cells. The ED₅₀ for this effect is typically <0.01ng/mL.

Recombinant Rat GM-CSF Protein (rp155067)-SDS-PAGE
3μg/lane of Recombinant Rat GM-CSF Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a single band at 13.7 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

4 results found

Lot NumberCertificate TypeDateItem
ZJ25F0521942Certificate of AnalysisApr 13, 2026 rp155067
ZJ25F0521943Certificate of AnalysisApr 13, 2026 rp155067
ZJ23F0600299Certificate of AnalysisJun 09, 2023 rp155067
ZJ23F0600298Certificate of AnalysisJun 09, 2023 rp155067
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.