Recombinant Human BMP3 Protein, >95% (SDS-PAGE&HPLC)

Cat. No.: rp143300
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. Azide Free ? Azide-free — without sodium azide preservative. Use in conjugations, cell work, or assays where azide is toxic or inhibitory. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. ≥95%(SDS-PAGE&HPLC)
Accession #
P12645
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Fully biologically active when compared to standard. The ED50 as determined by its ability to inhibit BMP-2-induced activity in murine MC3T3‑E1 cells.
Size
USA
Germany (EU)*
Price
Qty
10μg
rp143300-10μg
9 In stock
$193.90
50μg
rp143300-50μg
4 In stock
$539.90
100μg
rp143300-100μg
1 In stock
$859.90
1mg
rp143300-1mg
US Made to order · 2–4 wks ·
$5,199.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥95%(SDS-PAGE&HPLC) ActiBioPure™,Animal Free,Azide Free,Bioactive,Carrier Free,High Performance for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

Purity
>95% (SDS-PAGE&HPLC)
Endotoxin level
<1.0 EU/μg
Function
Bone morphogenetic protein 3, also known as osteogenic, is a protein in humans that is encoded by the BMP3 gene. The protein encoded by this gene is a member of the transforming growth factor-beta superfamily. It, like other bone morphogenetic proteins (BMP's), is known for its ability to induce bone and cartilage development. It is a disulfide-linked homodimer. It negatively regulates bone density. BMP3 is an antagonist to other BMP's in the differentiation of osteogenic progenitors. It is highly expressed in fractured tissues. Negatively regulates bone density. Antagonizes the ability of certain osteogenic BMPs to induce osteoprogenitor differentitation and ossification.

Specifications

Product Name
Recombinant Human BMP3 Protein, >95% (SDS-PAGE&HPLC)
Synonyms
BMP3 | BMP-3 | BMP3A | BMP-3A | Bone morphogenetic protein 3 (osteogenic) | Bone morphogenetic protein 3 | Bone morphogenetic protein 3A | Bone morphogenetic protein-3 | Osteogenin | BMP-3 | BMP-3A | Bone morphogenetic protein 3A | Osteogenin
Grade
ActiBioPure™, Animal Free, Azide Free, Bioactive, Carrier Free, High Performance
Specifications & Purity
ActiBioPure™, Bioactive, Animal Free, Carrier Free, Azide Free, High performance, ≥95%(SDS-PAGE&HPLC)
Purity
>95% (SDS-PAGE&HPLC)
Bioactivity
Fully biologically active when compared to standard. The ED50 as determined by its ability to inhibit BMP-2-induced activity in murine MC3T3‑E1 cells.
Endotoxin Concentration
<1.0 EU/μg
Expression System
E. coli
Species
Human
Amino Acids
363-472 aa
Sequence
QWIEPRNCARRYLKVDFADIGWSEWIISPKSFDAYYCSGACQFPMPKSLKPSNHATIQSIVRAVGVVPGIPEPCCVPEKMSSLSILFFDENKNVVLKVYPNMTVESCACR
Protein Tag
No tag
Accession #
Predicted molecular weight
24.8 kDa
SDS-PAGE
24.8 kDa
Molecule Type
Protein
Storage and Shipping
Shape
Lyophilized
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 4 mM HCl to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
12 months from date of receipt, -20 to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. 3 months, -20 to -70 °C under sterile conditions after reconstitution. Upon receipt, it is recommended to aliquot. Avoid freeze/th
Images

Recombinant Human BMP3 Protein (rp143300) - SDS-PAGE
Recombinant Human BMP3 Protein was resolved with SDS-PAGE under reducing (R) and visualized by Coomassie® Blue staining, showing a band at 24.8 kDa.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDateItem
ZJ24F0505680Certificate of AnalysisMay 24, 2024 rp143300
ZJ24F0505681Certificate of AnalysisMay 24, 2024 rp143300
ZJ24F0505682Certificate of AnalysisMay 24, 2024 rp143300
Documents & Articles
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.