Recombinant Human VEGF Protein, >95%(SDS-PAGE), CAS No.127464-60-2

CAS: 127464-60-2 Cat. No.: rp155965 Molecular Weight: 19.2 kD(单体)
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. High Performance ? High-performance grade with optimized purity and performance characteristics. Use for sensitive analyses where ordinary grades fall short. ≥95%(SDS-PAGE)
Expression System
Oryza sativa
Accession #
P15692-4
Protein Tag
No tag
Expression system
Oryza sativa
Endotoxin Concentration
<0.2 EU/μg
Bioactivity
The ED50 value was lower than 10.0 ng/ml, that is, the corresponding active unit was greater than or equal to 1 x 10^5 units/mg by primary HUVECs cell proliferation method.
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp155965-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$189.90
50μg
rp155965-50μg
1
$579.90
100μg
rp155965-100μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$799.90
1mg
rp155965-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$2,487.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,High Performance,≥95%(SDS-PAGE) ActiBioPure™,Animal Free,Bioactive,Carrier Free,High Performance for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 1 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Overview

VEGF permeability factor, also known as Vascular permeability factor (VPF), is a highly specific permeability factor for endothelial growth factor. It can promote the increase of vascular permeability, extracellular matrix degeneration, vascular endothelial cell migration, proliferation and angiogenesis. VEGF has also been shown to have chemotaxis on monocytes and osteoblasts.OsrhVEGF is expressed by oryza sativa and purified by protein purification technology.

Specifications

Product Name
Recombinant Human VEGF Protein, >95%(SDS-PAGE), CAS No.127464-60-2
Synonyms
MVCD1 | VAS | Vascular endothelial growth factor A | Vascular permeability factor | Vasculotropin | VEGF | VEGFA | VEGF-A | VEGFMGC70609 | VPF | VPFvascular endothelial growth factor | OsrhVEGF | Recombinant Human Vascular Endothelial Growth Factor from O
Grade
ActiBioPure™, Animal Free, Bioactive, Carrier Free, High Performance
Specifications & Purity
Animal Free, Carrier Free, Bioactive, ActiBioPure™, High Performance, ≥95%(SDS-PAGE)
Biochemical and Physiological Mechanisms
Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 re
Purity
>95%(SDS-PAGE)
Bioactivity
The ED50 value was lower than 10.0 ng/ml, that is, the corresponding active unit was greater than or equal to 1 x 10^5 units/mg by primary HUVECs cell proliferation method.
Endotoxin Concentration
<0.2 EU/μg
Expression System
Oryza sativa
Species
Human
Amino Acids
27-191 aa
Sequence
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Protein Tag
No tag
Protein Length
Full length protein
Accession #
Source
Recombinant
Predicted molecular weight
19.2 kDa
SDS-PAGE
19.2 kDa
CAS
127464-60-2
Molecule Type
Protein
Storage and Shipping
Shape
Lyophilized
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water to a concentration of 100-200 μg/mL. Stock solutions should be stored at 4℃ for 2-7days, stored at -20℃ for long term use, please use as soon as possible to avoid contamination.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20℃ for 3 years. Upon delivery aliquot. Avoid freeze/thaw cycle.
Images

Recombinant Human VEGF Protein (rp155965)-Protein Bioactivity
Measured in a cell proliferation assay using HUVEC human umbilical vein endothelial cells. The ED₅₀ for this effect is typically <10ng/mL.

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDateItem
ZJ23F0600447Certificate of AnalysisJun 30, 2023 rp155965
ZJ23F0600446Certificate of AnalysisJun 30, 2023 rp155965
ZJ23F0600445Certificate of AnalysisJun 30, 2023 rp155965
Documents & Articles
Aladdin® Target Proteins
General Guidelines for Cell Culture
Comprehensive Overview of Vascular Endothelial Gth Factors (VEGF)
Mammalian Cell Cryopreservation Protocol
GMP
Angiogenic Factors: Molecular Classes, Regulatory Mechanisms, and Experimental as Well as Translational Applications
Key Nodes and Representative Mechanisms in Angiogenic Regulatory Networks: A Structured Review
FGF2-Induced Angiogenesis Model: Standard Operating Procedure (Protocol)
VEGF Signaling Pathway: Receptor Lineage, Activation Mechanisms, and Biological Effects
Citations of This Product
References
1. Zeyu Liu, Yanxin Liu, Tongyu Shi, Kun Fu.  (2025)  Injectable Antimicrobial Quaternary Chitosan Salt/Tannic Acid as a Delivery Platform for Enhanced Cranial Bone Regeneration via the Synergy of BMP-2 and VEGF.  ACS Applied Bio Materials,      [PMID:40838706] [10.1021/acsabm.5c00935]
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.